Protein Info for DVU0253 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: oxidoreductase, FAD/iron-sulfur cluster-binding domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 941 PF01565: FAD_binding_4" amino acids 43 to 180 (138 residues), 110.6 bits, see alignment E=1.6e-35 PF02913: FAD-oxidase_C" amino acids 269 to 516 (248 residues), 194.4 bits, see alignment E=8.1e-61 PF13183: Fer4_8" amino acids 539 to 613 (75 residues), 38.7 bits, see alignment E=3.8e-13 PF13534: Fer4_17" amino acids 541 to 614 (74 residues), 28.5 bits, see alignment 5.2e-10 PF12838: Fer4_7" amino acids 541 to 613 (73 residues), 37.1 bits, see alignment 1.1e-12 PF02754: CCG" amino acids 710 to 780 (71 residues), 17.4 bits, see alignment 1.2e-06 amino acids 839 to 886 (48 residues), 12.8 bits, see alignment 3.3e-05

Best Hits

KEGG orthology group: K06911, (no description) (inferred from 100% identity to dvu:DVU0253)

Predicted SEED Role

"Predicted D-lactate dehydrogenase, Fe-S protein, FAD/FMN-containing" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FG1 at UniProt or InterPro

Protein Sequence (941 amino acids)

>DVU0253 oxidoreductase, FAD/iron-sulfur cluster-binding domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLPTAYKTFLRHLLECVPRERVFTDPLRTLAYGTDASFYRLIPKVVVDTHTEDEVVAILK
LAHRMRLPVTFRAAGTSLSGQSVTDSILVRLGDGWRKYAIFDNATKIRLQPGIIGSHANR
LLAEFGKKIGPDPASIDTAKIGGIVANNASGMCCGVAENSYKTLHRMRLVLADGTVVDTG
DDKSRAAFGRSHGAILEGLAALRQRVLDTPGLADRIRHKFKIKNTTGYSLNALVDFSDPF
EIMQHLMVGSEGTLGFISEVTYHTVTEHPHKASALVIFPTIRDACEATTILRGEPVSAVE
LMDSAALCSVADKPGMPGCLIGLSGQAAALLVETRAAEKSKLEEQIARITASIDAIPKVG
PVEFTDIPAEFGKLWAVRKGLFPAVGAVRKVGTTVIIEDVAFPIARLADATVELQGMFAK
HGYTEAIIFGHALEGNLHFVFTQDFNSPAEIERYRAFMDDVATMVVERYDGSLKAEHGTG
RNMAPFVEMEWGHDAYVLMKEIKTLFDPNGLMNPGVIINEDAEAHVKHLKPLPPAHSIID
KCIECGFCEPVCPSRNVTFTPRQRIVGWREIRRMQDGAEKSRLLRELFSGYGYLGDDTCA
TDGLCATRCPVGINTGSFIKELRADQTGKYATRSADWVAKHFGLVCRTVNTSLKTVDLLH
GLVGTDVMEKGSSFLRVVSLKKIPLWNRAMPGGSSVPRSGGMATVPGRRVVYFPSCIARS
MGPARDDNERDPLPAKTVSLLIKAGYEVLFPERLGDLCCGQPFESKGFKAQADMKAKELD
AALLKVSNDGEYPVLCDTSPCLMRMRETLDRRLKLYEPIEFALEHLTDKLTFTRLERKVA
LHATCTARKMGLEGKLLQLAQLCATETVVPEDIYCCGFAGDRGFSFPELNAGALAGLREQ
VETCTEGYSTSRTCEVGLSLHGRIPYRNILYLVDEATSPMR