Protein Info for DVU0179 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: molybdenum-pterin binding domain protein/site-specific recombinase, phage integrase family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF00589: Phage_integrase" amino acids 65 to 226 (162 residues), 38.7 bits, see alignment E=1.4e-13 TIGR00638: molybdenum-pterin binding domain" amino acids 252 to 319 (68 residues), 59.3 bits, see alignment E=1.4e-20 PF03459: TOBE" amino acids 254 to 317 (64 residues), 51.1 bits, see alignment E=1.9e-17 amino acids 402 to 462 (61 residues), 46.5 bits, see alignment E=5.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0179)

Predicted SEED Role

"molybdenum-pterin binding domain protein/site-specific recombinase, phage integrase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FN4 at UniProt or InterPro

Protein Sequence (465 amino acids)

>DVU0179 molybdenum-pterin binding domain protein/site-specific recombinase, phage integrase family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKDVAVSDDEVARARQEADGAPRKQAQVAAADGVAPGHPGLTVAGRHGAATGGALAFEVP
DDVRYLTAEQLERLTSSFRAWYGAASNATQRRARGRLWLAFLLFRFGALRLGEVLGIDDE
ADVDRGHALLHVRGVQPRDVPLPEPVMAEVLRVLDDPMMFSLRGQVLRLDPGYLRRRFYE
RSGGCGIPRDHLSPRVLRHSRAIELLRGGVPLKVVQQVLGHQSVSLAGNLLRFSEDDARR
ILRNYLRKESRVRTSARNAFTGRVVSVRRSGFLVEVETLTPSGLRVVSIITEESRHSLDI
APGALVTATVKAPWVMLAPAGTGATGPGQPFMGQTGTDASADQPTVAPPVVAQAATPAAC
REDESRETPCLAAACQAGADATRGEDAAGMDVVKGGGCSLVRNRYAGVVARVHDGGVAAE
VVVDLPEGTTLCALVSGACVRELALAEGVPVTVLFKAFSVILNVV