Protein Info for DVU0177 in Desulfovibrio vulgaris Hildenborough JW710

Name: modA
Annotation: molybdenum ABC transporter, periplasmic molybdenum-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF12849: PBP_like_2" amino acids 37 to 256 (220 residues), 29.5 bits, see alignment E=1.6e-10 PF13531: SBP_bac_11" amino acids 45 to 266 (222 residues), 202 bits, see alignment E=3e-63 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 50 to 265 (216 residues), 215.7 bits, see alignment E=3.6e-68 PF12974: Phosphonate-bd" amino acids 50 to 266 (217 residues), 41.7 bits, see alignment E=2.3e-14 PF01547: SBP_bac_1" amino acids 50 to 259 (210 residues), 76.8 bits, see alignment E=7.8e-25 PF04069: OpuAC" amino acids 61 to 219 (159 residues), 30 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 36% identical to YVGL_BACSU: Putative ABC transporter substrate-binding lipoprotein YvgL (yvgL) from Bacillus subtilis (strain 168)

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 100% identity to dvl:Dvul_2791)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FN6 at UniProt or InterPro

Protein Sequence (269 amino acids)

>DVU0177 molybdenum ABC transporter, periplasmic molybdenum-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSMSSRFAFLRRFTLCKALHRGALVLFLVAALLGIRTGDALAGNITVSAAASLTNAFTEL
KTLFEKKTGDTVTTNFAASNPLLRQMQEGAPVDVFASADQETMDKAAAGGLVDKATRKDF
ATNGLVLIVPAASTLKIAAASDLKAAEVRHIAVGNPDSVPAGRYARAALTAAGLWETLTP
KLIVAESVRQALDYVARGEVDAGFVYATDAAIARDKVRVAATMTGHKPVSYPIAVATAAR
DAETAKRFVAFVLSPEGQAVLARYGFGKP