Protein Info for DVU0172 in Desulfovibrio vulgaris Hildenborough JW710

Name: phsB
Annotation: thiosulfate reductase (phsB) (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF13247: Fer4_11" amino acids 58 to 145 (88 residues), 83.9 bits, see alignment E=2.7e-27 PF12838: Fer4_7" amino acids 59 to 105 (47 residues), 31.2 bits, see alignment 8.4e-11 PF13187: Fer4_9" amino acids 59 to 103 (45 residues), 30 bits, see alignment 1.5e-10 PF12837: Fer4_6" amino acids 84 to 106 (23 residues), 26 bits, see alignment (E = 2.3e-09) PF12797: Fer4_2" amino acids 84 to 104 (21 residues), 26.9 bits, see alignment (E = 1.1e-09) PF00037: Fer4" amino acids 86 to 105 (20 residues), 24.4 bits, see alignment (E = 6.5e-09)

Best Hits

KEGG orthology group: K04014, formate-dependent nitrite reductase, Fe-S protein (inferred from 100% identity to dvu:DVU0172)

Predicted SEED Role

"polysulfide reductase, subunit B" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FP1 at UniProt or InterPro

Protein Sequence (333 amino acids)

>DVU0172 thiosulfate reductase (phsB) (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MSRYCIVTDQDRCISCKACEVHCKVANNVPVGARLGMHIASGPHDVDGRPDIRTMFMPCF
QCDEPWCVPVCPTGAIAKRESDGIVAIDADTCVGCKACITACPWRVPQWNPVTEKAVKCD
LCRDRLDAGLRPACVTACTTHALELVSAEVGASLPCTGIDAVRKVAARPVPASMPPAPKG
QRQPRLGDVEKAIAAGEVQTLVVLCQALDDALPTPYEAGCIPQGMALSDARLRPDLGDVP
LPPQTMLRKVRCARRFAAKSLPKFLAAGLKALLVFACPPTMCASHEDGKIPATGLADLAR
ACADAGVRLVVHEACPAGPDAVRDAVAAFSRQA