Protein Info for DVU0171 in Desulfovibrio vulgaris Hildenborough JW710

Name: patB
Annotation: hemolysin-related protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR04350: putative C-S lyase" amino acids 9 to 388 (380 residues), 418.3 bits, see alignment E=1.4e-129 PF00155: Aminotran_1_2" amino acids 44 to 384 (341 residues), 125.8 bits, see alignment E=1.2e-40

Best Hits

KEGG orthology group: K14155, cystathione beta-lyase [EC: 4.4.1.8] (inferred from 100% identity to dvl:Dvul_2797)

Predicted SEED Role

"Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FP2 at UniProt or InterPro

Protein Sequence (393 amino acids)

>DVU0171 hemolysin-related protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTAFDHTFDTLIDRTGTGSLKWDDMERIFGPVPQNAIPLWVADMDFHAPEAVQNAVKDV
AAQGIYGYPAESSAPREAAATWLADRHGWAPGKESLVTVPGVVPGMALLIRELTAPGDGV
AVQPPVYPPLFDCVRAAGRRVVENPLVETDGRWGMDLGGLEGIFKGGVRLLLLCSPHNPV
GRVWTRDELSALADLCQRYGVMVVADEIHHDLVLPGHTHTVFASLPQCQPDRVVTCVSAS
KSFNLGGLPHAYVVATDGALRQRIAHAVVGRGLAHGDLFGMVAQEAAHRHGAPWLDALRM
YIADNAAMLQDRLHSHLPWVRMATLEGTYLAWLDCRASGMDETTMMRRLVAAGVVPSGGR
FFGTGGEGHLRVNLATPRTRLSAAIARMIVGLA