Protein Info for DVU0170 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: methyl-accepting chemotaxis protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details PF00015: MCPsignal" amino acids 343 to 509 (167 residues), 151.7 bits, see alignment E=1.9e-48 TIGR02481: hemerythrin-like metal-binding domain" amino acids 557 to 682 (126 residues), 128.7 bits, see alignment E=6.6e-42 PF01814: Hemerythrin" amino acids 566 to 681 (116 residues), 68.2 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to dvu:DVU0170)

Predicted SEED Role

"FIG00602666: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FP3 at UniProt or InterPro

Protein Sequence (689 amino acids)

>DVU0170 methyl-accepting chemotaxis protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKGSRVITAAFVVLVLTLIGTVLLHVQVERYHAQRETAAEGLMQVSAEGSRLVQFYGSGK
DAGEGAGVATLERKVSSLRASLRGLHEGRENPDLAASLGSLAEQVQGLKVAMESAARPEE
MLRRTADLSQAAARAENLVDKAIEGRVGWMSRLEGAMLFVTFLGVVLAAFLLQWRVFRPL
SMVEAYAREPNGERLALGRGVARGVAAMGAAVDDMHRDRDRALENAERELEALRAEKRAL
EEPLRRAEEQERMVAALMKGMKDAASRAGGVSEGVFGAVEEMNGWIERVNRGIEVHHSRM
GQVSEAMDEMNVASVEVARNSGGAARSAESARTLAGTGADRVREALDAISAMQRRVLELR
DTMGELGHRAEAIGRIMDVINDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAE
KTMGATKEVGDAVQAMQSQARTSIAGVEEVGRQMEGTAAAAEGAGGAMGEIVGVVEQTSM
QVGAIATAAEQQAAGLESISEAIGEISRVAGETAESMRQCTRALQGIGSRMEELDTVVQS
MAEGRVGLAGGGDKLFEWDDALNIGVADVDPQHKVLVDLINEVYAAMKAGADRSVLQDIV
RRLREYTVKHFTYEEGVLHTSMRYPDMQAHLKQHRAFVERIAQFEEALGSGRVTLDMEMM
RFLKNWLKQHIMGTDKKYVPYFNGDGTPK