Protein Info for DVU0168 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: oligopeptide/dipeptide ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 100 (100 residues), 42.5 bits, see alignment E=6.7e-15 PF00528: BPD_transp_1" amino acids 113 to 320 (208 residues), 135.4 bits, see alignment E=1.9e-43

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to dvl:Dvul_2800)

Predicted SEED Role

"Peptide ABC transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FP5 at UniProt or InterPro

Protein Sequence (325 amino acids)

>DVU0168 oligopeptide/dipeptide ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFAFIIRRVAQALLVMFIISLLGFAIKYSFGDPTREMMGVSVSVKEREALREELGLNDPF
AVQWTRFASGALKGDLGISYFYRKPALDVILDKAPATLELVFVAACLIILISVPVGVYAA
CRPKDVLSRLFMGVSTIGVSVPVFLTAIFLIYIFSVNLGWLPSFGRGNPEHVIGSWDTNL
TTWANFKHIILPGISLSSIMLPLFIRLIRAEMKEVLETEYVKFARAKGLKTWRVIMVHAF
KNTLLPVITVGGVQLGTMIAFTILTETVFQWQGMGFMFIDAVERADTSLLVAYLIFCGAI
FVTVNTVVDIVYGLVNPMVRIAGRK