Protein Info for DVU0167 in Desulfovibrio vulgaris Hildenborough JW710

Name: oppC
Annotation: oligopeptide/dipeptide ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 218 to 245 (28 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details PF12911: OppC_N" amino acids 13 to 63 (51 residues), 33.5 bits, see alignment 3.1e-12 PF00528: BPD_transp_1" amino acids 110 to 303 (194 residues), 97.2 bits, see alignment E=1e-31

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to dvu:DVU0167)

Predicted SEED Role

"oligopeptide/dipeptide ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FP6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DVU0167 oligopeptide/dipeptide ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVALIRRFRKSYFLYSFLRDPVAVGSFALLFILAVSAILAPLIAPHSPYDGATLDIMNAE
LPPAWKPEGTADFLLGTDNQGRDILSAMLYGMRVSLVIGLGAVALQSVIGIFVGLVSGYG
SKRIDSILMRVADVQLSFSSYMVAIFFGAILQMVVGVGRYEEVAVPFLIFVIGLSEWPQI
ARTVRASVLAEKKKEYVEAARVIGLPARRIMLRHILPNTLTPVLVISTVQVANAVMSEAA
LSFLGLGMPVTQPSLGSLIKSGFQYFFSGSWWITLFPGIMLILLVLSINLLGDWLRDFLN
PKLYKD