Protein Info for DVU0164 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cation efflux family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 5 to 286 (282 residues), 213.7 bits, see alignment E=1.7e-67 PF01545: Cation_efflux" amino acids 10 to 202 (193 residues), 150 bits, see alignment E=7.4e-48 PF16916: ZT_dimer" amino acids 207 to 284 (78 residues), 46.2 bits, see alignment E=4.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2804)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FP9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DVU0164 cation efflux family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSEQRRAIALSLVCGVCILVLKMLAYLVTDSAALMSDAFESIVNVVASAFTMWTLYVAQT
PPDRRHPYGHGRVEFFAVFFEGALVIVAALGIIVAAAPRIIEPRAMVQLDIGLGLSVVAS
AINLVLGLYLIRVGRREDRLALVADGKHIITDVYTTGGVLAGLLLVHATGWLWLDGAIAC
VVALHILGAGYGLVREAVRGLMNERDEKLLLRIEDVLRRHEQDDGIATHDIRAWRSGRDI
HVDLHLVLPRHMTMEQAQARATVVEDILRGQIPHVVEVLVRAEACDEAQCSACRHAGRCH
ER