Protein Info for DVU0161 in Desulfovibrio vulgaris Hildenborough JW710

Name: purF
Annotation: amidophosphoribosyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR01134: amidophosphoribosyltransferase" amino acids 6 to 447 (442 residues), 535.7 bits, see alignment E=5.9e-165 PF13230: GATase_4" amino acids 67 to 117 (51 residues), 29 bits, see alignment 8e-11 PF13522: GATase_6" amino acids 69 to 200 (132 residues), 67.6 bits, see alignment E=1.7e-22 PF13537: GATase_7" amino acids 86 to 204 (119 residues), 73.4 bits, see alignment E=2.6e-24

Best Hits

Swiss-Prot: 50% identical to PUR1_BACSU: Amidophosphoribosyltransferase (purF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to dvu:DVU0161)

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FQ2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>DVU0161 amidophosphoribosyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIRHYCGIFGIYNHAEAARLSYFGLYALQHRGQESAGIVTWDGQKLREHRGMGLVPEVFN
ERHLGKELKGDIAIGHIRYSTTGASLIRNAQPFIVRYKGLEIAIAHNGNLVNTLELRREL
EEQGSIFQTSIDSEVFVHLIARNLNGHTLEEAVMAACRKVKGAYALLILANNKLIAVRDP
HGFRPLALGRVAGAHVFASETCAFDLLEAEFIRSLDPGEMVVIEDTKVQSYKIETEAPTR
QCIFELIYFARPDSLVFGEDVYQCRKRMGQELARESAPDVDFVMPFPDSGVYSAVGFAQE
SGLPYEHAMIRNHYVGRTFIQPSQDMRDFSVRVKINPVKSMIKGKRICIVDDSIVRGTTI
RTRVKKLRELGAREVHFRVSCPPIKFPCFYGIDFASKGELIAANHSVSEIERFIGIDSLH
YITIEGLLRSVSHPENYCLACFTGDYPIPCAGGGKLCLECGC