Protein Info for DVU0161 in Desulfovibrio vulgaris Hildenborough JW710

Name: purF
Annotation: amidophosphoribosyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01134: amidophosphoribosyltransferase
  • amino acids 6 to 447 (442 residues), 535.7 bits, E=5.9e-165
• PF13230: GATase_4
  • amino acids 67 to 117 (51 residues), 29.4 bits, 5.9e-11
• PF13522: GATase_6
  • amino acids 69 to 200 (132 residues), 68.6 bits, E=8.4e-23
• PF13537: GATase_7
  • amino acids 85 to 204 (120 residues), 76.2 bits, E=3.4e-25

Best Hits

Swiss-Prot: 50% identical to PUR1_BACSU: Amidophosphoribosyltransferase (purF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to dvu:DVU0161)

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

See Q72FQ2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>DVU0161 amidophosphoribosyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIRHYCGIFGIYNHAEAARLSYFGLYALQHRGQESAGIVTWDGQKLREHRGMGLVPEVFN
ERHLGKELKGDIAIGHIRYSTTGASLIRNAQPFIVRYKGLEIAIAHNGNLVNTLELRREL
EEQGSIFQTSIDSEVFVHLIARNLNGHTLEEAVMAACRKVKGAYALLILANNKLIAVRDP
HGFRPLALGRVAGAHVFASETCAFDLLEAEFIRSLDPGEMVVIEDTKVQSYKIETEAPTR
QCIFELIYFARPDSLVFGEDVYQCRKRMGQELARESAPDVDFVMPFPDSGVYSAVGFAQE
SGLPYEHAMIRNHYVGRTFIQPSQDMRDFSVRVKINPVKSMIKGKRICIVDDSIVRGTTI
RTRVKKLRELGAREVHFRVSCPPIKFPCFYGIDFASKGELIAANHSVSEIERFIGIDSLH
YITIEGLLRSVSHPENYCLACFTGDYPIPCAGGGKLCLECGC