Protein Info for DVU0158 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein TIGR00104 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00104: tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA
  • amino acids 4 to 133 (130 residues), 97.6 bits, E=3.7e-32
• PF01980: TrmO_N
  • amino acids 21 to 132 (112 residues), 67.7 bits, E=1.1e-22
• PF00596: Aldolase_II
  • amino acids 154 to 328 (175 residues), 143 bits, E=1e-45

Best Hits

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 100% identity to dvl:Dvul_2810)

Predicted SEED Role

"COG1720: Uncharacterized conserved protein"

MetaCyc Pathways

• L-fucose degradation I (2/4 steps found)
• lactate biosynthesis (archaea) (2/5 steps found)
• D-arabinose degradation II (1/4 steps found)
• nucleoside and nucleotide degradation (halobacteria) (2/6 steps found)
• superpathway of fucose and rhamnose degradation (4/12 steps found)
• superpathway of pentose and pentitol degradation (4/42 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17

Sequence Analysis Tools

See Q72FQ5 at UniProt or InterPro

Protein Sequence (332 amino acids)

>DVU0158 conserved hypothetical protein TIGR00104 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQPVLRPIGTVRSRLTRLDDCPKNGDEGAPEAWIDILPEFAAGLDTLEAGQELTLVTWLH
LADRDTLAVHPRGDTSRPMRGVFNTRSPARPNPLGLHDVRLLGTAPGPDGMVRLLVAPLE
ALHGTPVVDIKTSLSQRRDTGWGDGVPLREAETVRRLCHTAWQRGLLSGFNGNVSLRLGA
TCLVTCTGAAKGDLSPGDLAVVDIASGKRIAGGKPSSELAMHLEVYRRQPRAQAIVHTHP
PRLLALGLRVAPQQMLHIDVYEAQMLVSRLGSAPAHAPGTQALADAVGEAAVTREAVWME
RHGLVCWGETPMQALALGEELEHLAGIHLSVL