Protein Info for DVU0149 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 182 to 208 (27 residues), see Phobius details amino acids 215 to 241 (27 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details PF01925: TauE" amino acids 20 to 296 (277 residues), 148.3 bits, see alignment E=1.6e-47

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dvu:DVU0149)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FR4 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DVU0149 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEWLYILMPIAGVKIFWPGLIILGVGVGIIGGFFGMGGAWMVTPGLNILGFPMAFAIGTD
IAHMAGKSLISTMRHGKFGNVDYKLGMIMLVGTVVGFEAGAQMVMWLERLGSVEKVVRWI
YIVLLALIAWMVFHDVAKRRQKEREAAAKGVKLEAGATGVEWHKALHKIKIPPMVHLKEA
GIYCSAWLPIFVSFLTGWLAGILGIGGGLIRMPALIYLIGCPTHVAVGTDLFEVMISGLY
GAATYTYKGRTELVAAIIMLVGAAMGAQVGAVATKYIKGYGIRIAFGLAVVGCAISILMK
LVQPWVPQYKAFLDAGATVLVLGLVTCMSLYIFVRMVQGVQMELARKRAN