Protein Info for DVU0118 in Desulfovibrio vulgaris Hildenborough JW710

Name: ntrC
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 101.2 bits, see alignment E=1.4e-32 PF14532: Sigma54_activ_2" amino acids 141 to 311 (171 residues), 67.4 bits, see alignment E=5.8e-22 PF00158: Sigma54_activat" amino acids 141 to 306 (166 residues), 236.1 bits, see alignment E=6.4e-74 PF07728: AAA_5" amino acids 163 to 284 (122 residues), 29.1 bits, see alignment E=3.1e-10 PF25601: AAA_lid_14" amino acids 312 to 391 (80 residues), 81.9 bits, see alignment E=8.8e-27 PF02954: HTH_8" amino acids 410 to 450 (41 residues), 55.5 bits, see alignment 1.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0118)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FU5 at UniProt or InterPro

Protein Sequence (454 amino acids)

>DVU0118 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPHSILLVEDELSMRLGMQHALSRAGYEVAAADTAEAARHALHRRPFDLVITDLRLPGM
SGMELLDSIREMHPGTGVILITAFPEVELAVQAIKAGAFDFLCKPFQSDGLLIAVERFFR
FLDLKRENDRLRGEREEGEFIGESPAMLKVFDRIRALADACVPVLVLGPSGSGKELVAGA
LHRRSKRRDRPFIKINCAALPEQLLESELFGHEKGAFTGAQQARIGKFEAADGGTLFFDE
VGEMPLPLQAKLLRVLEDQEVTPVGGNTPRKVNVRTVFATARNLEEAIADGRFREDLYYR
INVVPVTLPPLRERGSDVALLTERFLRRFCALHERQATLSEQARLALLAYDYPGNVRELR
NAVEHAVLLCTEGEIHVGHLPERIRAATQSMPPACDDDAGDTPASLAEGVARFERRRIME
ALERTGGRKIQAADLLGISRKQLWLKLKELSIDI