Protein Info for DVU0109 in Desulfovibrio vulgaris Hildenborough JW710

Name: hydH
Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details PF00512: HisKA" amino acids 144 to 205 (62 residues), 49.9 bits, see alignment E=2.6e-17 PF02518: HATPase_c" amino acids 250 to 359 (110 residues), 84.4 bits, see alignment E=7.7e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0109)

Predicted SEED Role

"Sensor protein of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FV4 at UniProt or InterPro

Protein Sequence (368 amino acids)

>DVU0109 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNWKLIPPGGITSSLRLRVGLLLFLLVVVSMAAAALPLLMVGGRLTLPEPLADFAANPAA
DAIALLCTILFLAGLLGVVIYRQVLGPIRRLALEGAFGGEVTGNEVEVLVGRVRHLLDTM
HRTQAQLEESHETLRQTEKLALVGKLAAGVAHSVRNPLTSVKLRLFSLERSLTLDTQQRE
DFEVIADEIRHLDAIVSNFLEFSRRPKLRMQTVSPSDVVDNTLQLLKHRIESFNVQVQLH
RAERLPVVKGDPEQLKEALVNLVLNACEAMGYDGRLDITEERGIINPLGRAVVIRIADSG
PGVPIDRRDDIFQPFFSTKEEGTGLGLPIAKSIFEEHGGWLHLHSAPGRGATFVAVLPAL
KDDSWLRS