Protein Info for DVU0101 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: methlytransferase, UbiE/COQ5 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF13489: Methyltransf_23" amino acids 50 to 205 (156 residues), 56.2 bits, see alignment E=1.4e-18 amino acids 316 to 488 (173 residues), 31.2 bits, see alignment E=6.7e-11 PF01209: Ubie_methyltran" amino acids 61 to 167 (107 residues), 44.8 bits, see alignment E=4.2e-15 PF13847: Methyltransf_31" amino acids 66 to 176 (111 residues), 47.5 bits, see alignment E=6.9e-16 amino acids 320 to 428 (109 residues), 40.9 bits, see alignment E=7.1e-14 PF13649: Methyltransf_25" amino acids 69 to 162 (94 residues), 59.9 bits, see alignment E=1.3e-19 amino acids 323 to 420 (98 residues), 55.4 bits, see alignment E=3.2e-18 PF08241: Methyltransf_11" amino acids 70 to 166 (97 residues), 67.7 bits, see alignment E=4.8e-22 amino acids 324 to 423 (100 residues), 42.5 bits, see alignment E=3.3e-14 PF08242: Methyltransf_12" amino acids 70 to 163 (94 residues), 36 bits, see alignment E=3.9e-12 amino acids 324 to 422 (99 residues), 47.5 bits, see alignment E=9.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0101)

Predicted SEED Role

"methlytransferase, UbiE/COQ5 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FW2 at UniProt or InterPro

Protein Sequence (508 amino acids)

>DVU0101 methlytransferase, UbiE/COQ5 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPLHGAATPASASAAGSMKASHEASADPRSRFFDERAATWEQRCYPPEARRRLAALVPR
FGVERGDCVLDMGTGTGVLIPYLRDGVGDAGRILSFDVSFEMVRRAGCKERDAKGLCVQA
TAMRIPARDGVFDRVVCFAAFPHFADKPAAMREMARVVRPGGEVVIAHLLSRAELARHHG
GHPAVAEDALPDDATMRGLMHDAGLVEGSITDGPGMYVARARKPRTCRAGEGGVPGTPGT
PGGRAGGSAGGEGAESAIAGDAEGNGSGVEAGFEARRVFTALKQNDAMHHSAVYGVLSGL
LRAFACDAALPHGAPGQGGALRILDVGCGEAADVVQALEGVTVGAYTGVDTSAPALAEAR
RHLAALGCPVTLIEGDYRLALNTSQGSVDVLWMGLFLHHLPRALKADFLHTAHGLLAPGG
MVLAHDPIMGEDDTRETMLARMEAIGRERWHFLTPEEVGMVHRHWSCHGHQERFSDLCAL
GEAAGFEVDMVWHDADRTYGLVRFMRRG