Protein Info for DVU0084 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: translation initiation factor, aIF-2BI family, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase" amino acids 7 to 334 (328 residues), 418.2 bits, see alignment E=2.2e-129 TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins" amino acids 31 to 334 (304 residues), 374.8 bits, see alignment E=2.9e-116 PF01008: IF-2B" amino acids 46 to 333 (288 residues), 281.2 bits, see alignment E=4.2e-88

Best Hits

Swiss-Prot: 100% identical to MTNA_DESVH: Methylthioribose-1-phosphate isomerase (mtnA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 100% identity to dvu:DVU0084)

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FX9 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DVU0084 translation initiation factor, aIF-2BI family, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MERHIRYDAASRSLILLDQRYLPTREEDFVCRNTDDIVTALQVMVVRGAPAIGVTAAWGC
VLAAYETAESGMETWRPVLDGLIERIANARPTAVNLRWAVERMRAAWHSLGRADLATLIT
YWTNEAKRIHRDDIAINRRMGEHGAELIDDGDAVMTHCNAGALATAGYGTALGVIRGAVE
AGKNITVIANETRPFLQGARLTAFELHEDGIPVTVACDNACGLLMKRGMVQKVVVGADRI
AANGDAANKIGTYSVALLAREHGIPFYVAAPLSTIDRETPDGDHIPIENRTPTEVTHVGA
TQITPDGVPVFNFAFDVTPAHLIAGIVTEMGVLRAPYRESIAEAFRKAGL