Protein Info for DVU0082 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 454 to 475 (22 residues), see Phobius details PF05368: NmrA" amino acids 9 to 121 (113 residues), 47 bits, see alignment E=7.1e-16 PF01370: Epimerase" amino acids 11 to 124 (114 residues), 45.8 bits, see alignment E=1.3e-15 PF01073: 3Beta_HSD" amino acids 13 to 124 (112 residues), 28 bits, see alignment E=2.9e-10 PF13460: NAD_binding_10" amino acids 15 to 128 (114 residues), 64 bits, see alignment E=4.3e-21 PF11066: DUF2867" amino acids 349 to 485 (137 residues), 116 bits, see alignment E=4.3e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0082)

Predicted SEED Role

"Putative nucleoside-diphosphate-sugar epimerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FY1 at UniProt or InterPro

Protein Sequence (530 amino acids)

>DVU0082 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDNDSTPRGTVCVTGATGYVGGRLVPRLLDHGWRVRALVRTPAKLLCRPWARHPRLDIIR
GDLDDACSLVPALEGCDAVFYLVHSMNPHVTGRDTFAKADRAAASNMVRACDEARPGRII
YLSGLVPEGEELSPHLRSRAEVADILARGETPLTVLRAAQILGSGSASFEMVRYLVDRLP
VMLTPRWVHSLCQPIAISNVLGYLEGCLDHPETMGQTYDIGGPDILSYRELFDIFAEVAQ
LRRRTIIPVPVLSPELSAHWINLVTPIPKALATPLIQGLRNRVVCADDRIRDIIPQRLLS
CREAIGKALDRVREQSVPTCWTDAGRPDMPEWMTCGDASYAGGDLLECAYAIQVEAPPET
VWKPVSAIGGETGWYHGDLLWRLRGMLDKLVGGPGLRRGRRHPTDIGVGDALDFWRVLDV
RPGERLLLLAEMKVPGDALLEFRLAPTATGGTELWMLSWFLPRGLAGLAYWWALYPLHKG
LFKGMLCGLAAATGAPVSREPWALPPRREFACALPLTDASAPGRRDTTAQ