Protein Info for DVU0081 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 PF00072: Response_reg" amino acids 32 to 140 (109 residues), 36 bits, see alignment E=2.4e-12 TIGR00229: PAS domain S-box protein" amino acids 178 to 290 (113 residues), 37 bits, see alignment E=1.6e-13 PF13188: PAS_8" amino acids 179 to 229 (51 residues), 29.7 bits, see alignment 1.6e-10 PF00989: PAS" amino acids 179 to 223 (45 residues), 31.6 bits, see alignment 5.2e-11 PF08448: PAS_4" amino acids 182 to 288 (107 residues), 47.1 bits, see alignment E=9.3e-16 PF00512: HisKA" amino acids 303 to 391 (89 residues), 27.6 bits, see alignment E=8.8e-10 PF02518: HATPase_c" amino acids 441 to 555 (115 residues), 73.2 bits, see alignment E=8e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2880)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FY2 at UniProt or InterPro

Protein Sequence (576 amino acids)

>DVU0081 sensory box histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLSTDPDMLDFIDDPQDDADSPLPASQGPWDVLVVDDDPAVLTVTNLVLKDVTFDGRAIA
LTGASSASEARTLLAEKEYAVLLLDVVMETEHAGLDLVRHMRDVMHNRRTRIIVRTGQPG
SAPQERVVHEYDINDYREKTSLTAHSLESSVVAALREYRHIRELEEARAALSAERAVSRA
VLDAMPSAVVVCDTEGRVQYWNNEASKLSGLSPDEALGFPFEDIAPALQLEAALLQAGLR
TTTPLRQARHASRHGRHTTYRDVVFYPAATAEGRQLVVRIDDVTDRVRMESLMLQTEKML
SLGGLAAGMAHEINNPLAVILQGADTVQRRLAPGLPANRDIAREIGLDLDLMHTYLERRK
LPRFIAGIAEAGRRAADIVENMLSFGRGDEGRRCAIDINKVVERALELAAHHYDLKKKYD
FRQILIVKDLAEGMPSIVCNPIEMEQVLFNLLQNAAQVLYEAPPQDARPTIHLQTRCVGR
LLEIRVTDNGPGVPHELARRIFEPFFTTKPPGMGTGLGLSVSYFIVSEHHGGTLRLERLR
LPEHGARFIVELPLDAMKEPGAEEGDDTHDCGGPVS