Protein Info for DVU0073 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: CDP-glucose-4,6-dehydratase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 5 to 355 (351 residues), 460.4 bits, see alignment E=2.1e-142 PF04321: RmlD_sub_bind" amino acids 10 to 169 (160 residues), 30.5 bits, see alignment E=6.1e-11 PF01370: Epimerase" amino acids 11 to 238 (228 residues), 103.5 bits, see alignment E=3.9e-33 PF16363: GDP_Man_Dehyd" amino acids 12 to 174 (163 residues), 106.6 bits, see alignment E=5.7e-34 PF01073: 3Beta_HSD" amino acids 12 to 191 (180 residues), 44 bits, see alignment E=4.5e-15 PF02719: Polysacc_synt_2" amino acids 57 to 225 (169 residues), 50.9 bits, see alignment E=3.9e-17

Best Hits

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 100% identity to dvu:DVU0073)

MetaCyc: 48% identical to CDP-D-glucose-4,6-dehydratase monomer (Yersinia pseudotuberculosis)
CDP-glucose 4,6-dehydratase. [EC: 4.2.1.45]

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FZ0 at UniProt or InterPro

Protein Sequence (368 amino acids)

>DVU0073 CDP-glucose-4,6-dehydratase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFGDIYRGRRVLVTGHTGFKGSWLTAWLLHLGAEVAGFSLDVPTSPANFEVLDLSGRISD
LRGDIRDRKAMCEAIEGFKPDVVFHLAAQALVRKSYDDPAGTIEANAMGTLNVLEAVRCT
PSVQAVVCITSDKCYRNDEWVWGYRETDHLGGEDPYSASKGCAEIIAQSYFKSFFKNGPR
CATTRAGNVIGGGDWAADRIVPDCARAWSQGRPVPIRSPWATRPWQHVLEPLSGYLWLGA
KLLVDAKGPFPLSGEAYNFGPAADVNNTVAEVVDALAPYWQGFSSEMDRAGQAGMKECTL
LKLCCDKSLAYLRWQATLTFAETIRFTAEWYRAFYAPTGGAQDMYAFTMGQILEYADKAR
AKGLEWTA