Protein Info for DVU0049 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: OmpA family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF13677: MotB_plug" amino acids 13 to 54 (42 residues), 57.7 bits, see alignment 6.8e-20 PF00691: OmpA" amino acids 123 to 230 (108 residues), 47.7 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 100% identity to dvu:DVU0049)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G14 at UniProt or InterPro

Protein Sequence (364 amino acids)

>DVU0049 OmpA family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARRTARRVTRTQEGQPGWLLTYSDLMTLLLAFFVLLVSMSTIDERRRRMVIESVFGGIG
LMQTGSGEASGDRLVPLTDPDAQHDARRDLGPLKATLDGAQGKGVDFFDNGNVQILSIDA
DVLFGPGETRLSKEGERLLATFAPTLRTIEHPLLVAGHASPPRDEQGAGFRLRAEGTLSP
SWMLSLRRATSVYRALRDLGVPSSRLILEGFGDGHPRHDAFTATGRRANRRVDLVLDKRN
LAWLQQRQGTARETQYDYKGFRFGLESPAPAGSPPAPPGAPGTTPDVIPGTPDAATPSSS
TATPQLPRAFDGVDGNGEVRAPALGPTLVPVRPGTTAAPAGVNRFAPPPEVTIPAPSPAS
EAVP