Protein Info for DVU0015 in Desulfovibrio vulgaris Hildenborough JW710

Name: lgt
Annotation: prolipoprotein diacylglyceryl transferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 3 to 251 (249 residues), 249.1 bits, see alignment E=2.8e-78 PF01790: LGT" amino acids 9 to 252 (244 residues), 285.2 bits, see alignment E=1.9e-89

Best Hits

Swiss-Prot: 100% identical to LGT_DESVH: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to dvl:Dvul_2948)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G45 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DVU0015 prolipoprotein diacylglyceryl transferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLTFPRIDPVAITLGPLQFRWYGLMYLFGFLSGWWLGRRRAAQPGSRWTGEMVDDMVTYV
ILGVVLGGRIGYILFYDLAYYLGNPTQIFSIWNGGMSFHGGLLGVVFAMWLLGRRNGLGF
MDVSDFVAPLIPPGLFFGRIGNFINGELWGKHTTLPWGMVFPDGGPFPRHPSQLYECALE
GVILFLALWVFSSRKRPTGHVSGLFALLYGVFRFTVEFVREPDVQLGYLAFGWLTMGQVL
CLPLIMLGLWLLRPGGDKGTKAA