Protein Info for DVU0014 in Desulfovibrio vulgaris Hildenborough JW710

Name: infA-1
Annotation: translation initiation factor IF-1 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 TIGR00008: translation initiation factor IF-1" amino acids 3 to 71 (69 residues), 124.6 bits, see alignment E=5.8e-41 PF01176: eIF-1a" amino acids 7 to 70 (64 residues), 102.6 bits, see alignment E=3.6e-34

Best Hits

Swiss-Prot: 100% identical to IF12_DESVV: Translation initiation factor IF-1 2 (infA2) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K02518, translation initiation factor IF-1 (inferred from 90% identity to dde:Dde_3769)

Predicted SEED Role

"Translation initiation factor 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61686 at UniProt or InterPro

Protein Sequence (72 amino acids)

>DVU0014 translation initiation factor IF-1 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKEDAIEVDGVVQEALPNAMFRVELQNGHEVLAHISGKMRKFYIRILPGDRVKVELSPY
DLKRGRITYRMK