Protein Info for DVU0009 in Desulfovibrio vulgaris Hildenborough JW710

Name: dctM
Annotation: DedA family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 54 to 73 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 303 to 347 (45 residues), see Phobius details amino acids 353 to 383 (31 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details PF06808: DctM" amino acids 7 to 415 (409 residues), 378.4 bits, see alignment E=2.1e-117 TIGR00786: TRAP transporter, DctM subunit" amino acids 19 to 418 (400 residues), 396.3 bits, see alignment E=6.8e-123

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0009)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G51 at UniProt or InterPro

Protein Sequence (426 amino acids)

>DVU0009 DedA family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTALVLFGMLGLLFACNAPIMLAVGASAFAALLIKGGMDPMVAVQRLYAGADSFPLLAVP
LFMTAGQLMSAGGISQRIVRLADTLVGHLPGGLAVVSVVSSMFFAGVSGSAAADTAAVGS
ILIPSMVARGYSPAFAGAVQAAAGSIGVVIPPSIPMIVFGALTGASIGKLFAGGVMPGLL
MGITLSAWCVHEGLRSGRETRRFEPAAVWPALLRAGWSLGAPAIILGGIISGVCTATEAA
AVAVVYAFLVGLFAHRELDLRRLPALLLDAAVTSGVVMSIIAAASLFGWVMAIERIPAAL
ADAILAVGGEGWMLLLAVNILLLLAGTMLETTAALILLVPVLVQLLPRMGIDLIHLGVIV
VMNLSIGMLTPPLGVCLMVSCGIARVPLATLARAVLPLLAVLVVDLMLVTYIPWFVAAFS
TDIIAP