Protein Info for DVU0001 in Desulfovibrio vulgaris Hildenborough JW710

Name: dnaA-1
Annotation: chromosomal replication initiator protein DnaA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF00308: Bac_DnaA" amino acids 106 to 261 (156 residues), 85 bits, see alignment E=7.1e-28 PF08299: Bac_DnaA_C" amino acids 343 to 411 (69 residues), 94.6 bits, see alignment E=3e-31

Best Hits

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to dvu:DVU0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G59 at UniProt or InterPro

Protein Sequence (437 amino acids)

>DVU0001 chromosomal replication initiator protein DnaA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLQQALRQHLRQTCSEQELHQWFDPLDLRLDDAQQRLEVRFPHPHFARWFEAQALERFTA
GVRDVVGTSVALVFPEGIKTTDRSTVQPPSQPPLASESVACPFGAAFTFDAFITNRKNQF
PLAAAREAARNGHQRTYNPFVLCGASGNGKTHLLRALANELAALYGTDAVFCGSAEELHD
RYNTEERLAMRRTLCAHRALLLDDLHRLRALPDLREELTALFDHFYDHGKQMAFAYAGRL
SDLDFLEAPLRSRLELGLIVDLKEPDLDVRVRYIHARCAALSLQLAREHVLTLAQRCHEF
RHLSGLLLKVAAYRDMVGRDILDRELEQILRNTDSGPERAVAPDTIISAAAEHFGVTPRD
ILSDKRQQHIVQARQVAMFLCRELIGSSFPALGRMFGGKDHSTAMYAVKKIKKLQYDNKD
MHALVAELKRRCLNHDG