Protein Info for DVU3384 in Desulfovibrio vulgaris Hildenborough JW710

Name: zraP
Annotation: zinc resistance-associated protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13801: Metal_resist" amino acids 11 to 120 (110 residues), 65.8 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 100% identical to ZRAP_DESVH: Zinc resistance-associated protein homolog (DVU_3384) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K07803, zinc resistance-associated protein (inferred from 99% identity to dvl:Dvul_0015)

Predicted SEED Role

"Zinc resistance-associated protein" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725P0 at UniProt or InterPro

Protein Sequence (173 amino acids)

>DVU3384 zinc resistance-associated protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNSKRIALGIIALATVVSLGTAANNAFARGHGNYHGQGQMMGQAYEALTPEKQAKFDSLI
DAFNTKVTPLRDKLWAKHTELNALSSNPNTKPEDIRKLTDEITALRTQYRTEAANLDASM
QKEVGIKTHFATMGHRGMGGMGGGCGMMGGKGGMGSGMMQMHDGEGPHRGQNM