Protein Info for DVU3384 in Desulfovibrio vulgaris Hildenborough JW710
Name: zraP
Annotation: zinc resistance-associated protein (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ZRAP_DESVH: Zinc resistance-associated protein homolog (DVU_3384) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
KEGG orthology group: K07803, zinc resistance-associated protein (inferred from 99% identity to dvl:Dvul_0015)Predicted SEED Role
"Zinc resistance-associated protein" in subsystem Zinc resistance
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q725P0 at UniProt or InterPro
Protein Sequence (173 amino acids)
>DVU3384 zinc resistance-associated protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MNSKRIALGIIALATVVSLGTAANNAFARGHGNYHGQGQMMGQAYEALTPEKQAKFDSLI DAFNTKVTPLRDKLWAKHTELNALSSNPNTKPEDIRKLTDEITALRTQYRTEAANLDASM QKEVGIKTHFATMGHRGMGGMGGGCGMMGGKGGMGSGMMQMHDGEGPHRGQNM