Protein Info for DVU3381 in Desulfovibrio vulgaris Hildenborough JW710

Name: ntrC
Annotation: transcriptional regulatory protein zraR (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 106.9 bits, see alignment E=2.7e-34 PF00158: Sigma54_activat" amino acids 144 to 310 (167 residues), 238.5 bits, see alignment E=1.3e-74 PF14532: Sigma54_activ_2" amino acids 145 to 315 (171 residues), 69.8 bits, see alignment E=1.2e-22 PF07728: AAA_5" amino acids 168 to 286 (119 residues), 28.4 bits, see alignment E=5.8e-10 PF25601: AAA_lid_14" amino acids 316 to 393 (78 residues), 98.7 bits, see alignment E=5.6e-32 PF02954: HTH_8" amino acids 415 to 456 (42 residues), 54 bits, see alignment 4.6e-18

Best Hits

KEGG orthology group: K07713, two-component system, NtrC family, response regulator HydG (inferred from 100% identity to dvl:Dvul_0017)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725P3 at UniProt or InterPro

Protein Sequence (459 amino acids)

>DVU3381 transcriptional regulatory protein zraR (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDVTVLIVDDDVAHRTMLRTMLRGWGYATDEADDGETAVEKVREKARDAVLMDVRMARM
GGIEALRRIVEYNPAVPVLIMTAYSSVETAVEALRLGAYDYLTKPLDFDVLRHTLERALD
HTRLVSENRELKSRLDDAARAPGIIGRSAPMRELAELVATVAPSEATVLITGESGTGKEL
VARSLHEGSRRSAKQLVTVNCAALSESLLESELFGHERGAFTGADKRRDGRFVQADGGTL
FLDEIGELPLLLQAKLLRALQQGEIQRVGSDVPLTVDVRLLAATNRDLREEVAAGRFRED
LFYRLNVIGIHMPALRERPDDIPLLAAHFLDRYAERNRKHLKGFTPQAMDMLLKHPWPGN
VRELENAVERAVIMATGDWVGERELPMSLRGAGGADPAVADAALPTGQDPYAGLSLEDLE
RRAIVATLRETGDNKSEAARRLGITRATLHNKLKKYDLE