Protein Info for DVU3379 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ribonucleoside-diphosphate reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00317: Ribonuc_red_lgN
  • amino acids 40 to 121 (82 residues), 80.3 bits, E=1.4e-26
• TIGR02504: ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent
  • amino acids 46 to 610 (565 residues), 721.6 bits, E=4.1e-221
• PF02867: Ribonuc_red_lgC
  • amino acids 124 to 600 (477 residues), 450 bits, E=1.8e-138
• PF12637: TSCPD
  • amino acids 632 to 733 (102 residues), 81.3 bits, E=8.2e-27

Best Hits

KEGG orthology group: K00525, ribonucleoside-diphosphate reductase alpha chain [EC: 1.17.4.1] (inferred from 100% identity to dvu:DVU3379)

Predicted SEED Role

"Ribonucleotide reductase of class II (coenzyme B12-dependent) (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

See Q725P5 at UniProt or InterPro

Protein Sequence (777 amino acids)

>DVU3379 ribonucleoside-diphosphate reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPVGAVFDKMNKIKQLKDTNGMNMAERLLPAPADLPDVALNPNAAVVLAKRYYRKGASGE
QLEDARDMFWRVASAIAAEETKYEASTWKHEDLAREFYDLMTGWRFLPNSPTLMNAGTDL
GQLSACFVLPVGDSIEEIFDAVKHAAMIHKSGGGTGFSFSRLRPKESRVGSTGGVASGPI
SFLRIFNTATEQIKQGGTRRGANMGILRIDHPDIMDFIRAKERDGEFNNFNLSVALTEAF
MQAVENDEDYPLIAPHSGLEKGRLKAREVFELLVRKAWESGDPGIVFIDRINRDNPTPDQ
GEIESTNPCGEQPLLPYEACNLGSVNLSAFFIPGHENDPNPADKGVDWKALKRVIHLGVR
FLDNVIDASRFPLERITERVHQNRKIGLGVMGWADLLFQLRIAYDSPEALHLGERMMAFV
RDEGRAASKQLAKERGPFPAYPASTFAERDLGPYRNATVTTIAPTGTLSILAGCSSGIEP
LFALSFARHVMDGERLVEVNPHFEAAARAEGCHSPRLMETVASKGSIHGMDHLPEAMRRV
FVTAMDIEPVWHLKMQAAFQQYTDNAVSKTVNLPNNATIEDIRNIYWMAYEEGCKGVTVY
RDGCKSVQVLCTGDGEKKAEGEAEGKGVVRQRPDVVYGFTQKVPTGLGAMYLTVNETDGK
PFEVFATIGKSGRSITAKAEAIGRLVSLALRSGVGVRDIVTQLKGIGGEHPVFQKKGLLL
SIPDAIAWVLETRYLQGSVPVHGGSDLERQRCPECGSELVFQEGCHICPACSFTKCG