Protein Info for DVU3375 in Desulfovibrio vulgaris Hildenborough JW710

Name: ftsE
Annotation: cell division ATP-binding protein FtsE, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR02673: cell division ATP-binding protein FtsE" amino acids 1 to 214 (214 residues), 286 bits, see alignment E=9.1e-90 PF00005: ABC_tran" amino acids 17 to 164 (148 residues), 114.9 bits, see alignment E=4.6e-37 PF13304: AAA_21" amino acids 120 to 199 (80 residues), 33.9 bits, see alignment E=3.5e-12

Best Hits

Swiss-Prot: 44% identical to FTSE_BACSU: Cell division ATP-binding protein FtsE (ftsE) from Bacillus subtilis (strain 168)

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 100% identity to dvl:Dvul_0022)

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725P9 at UniProt or InterPro

Protein Sequence (238 amino acids)

>DVU3375 cell division ATP-binding protein FtsE, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLDIRHLSHNYGSHWALKDCSFTLEKGGFLFLSGPSGAGKTTLLRLLHGALPLQRGQAQV
AGFDLARLRSHDLPALRRHVSVVFQDFRILPARTAFANIALPLEVRGLDARASGRRVRAV
ARALGLEHRLDTPAGELSGGEQQRVAVARAIVVNPQVLLADEPTGNLDPDLSLRLMDVFM
QFNAYGTTVVLATHNPELIRRNPAARLIHLDDGMITHANWPGARLSCRADACDLLEGP