Protein Info for DVU3374 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: permease, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 7 to 7 (1 residues), see Phobius details transmembrane" amino acids 8 to 30 (23 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 203 to 233 (31 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details PF02687: FtsX" amino acids 165 to 273 (109 residues), 41.7 bits, see alignment E=5.7e-15

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 100% identity to dvl:Dvul_0023)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725Q0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>DVU3374 permease, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MALHPLAHTLGLAAVTLAVFLGGVFLMALTTVDAEFRVSRGETVWQVYWRPGTPLEQVRP
QWDEVRRMPWLTRAETWTPDDALAALAKRLGGADALPSGGVNPLPPTALLVFSPREVDAG
RWARETQSFLKNLPGVERVTSTPLKDEFGRMWRGVSAFVVWPSVAFLTLVLALVSASSVR
LTLEHRRDEIEILKLVGARNWYIRLPLLVGGAMLGLVGGGAALALLHLVYRFVGPFFAVP
PLLMELHFPPPEQAVLLVAVPVLMGLTGGWMAVRDRN