Protein Info for DVU3369 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF13489: Methyltransf_23" amino acids 32 to 135 (104 residues), 55.1 bits, see alignment E=2.8e-18 PF07021: MetW" amino acids 34 to 134 (101 residues), 34.8 bits, see alignment E=4.7e-12 PF01209: Ubie_methyltran" amino acids 38 to 139 (102 residues), 41.8 bits, see alignment E=3e-14 PF13847: Methyltransf_31" amino acids 40 to 138 (99 residues), 43.6 bits, see alignment E=9.6e-15 PF08241: Methyltransf_11" amino acids 45 to 134 (90 residues), 78.7 bits, see alignment E=1.5e-25 PF13649: Methyltransf_25" amino acids 45 to 131 (87 residues), 71 bits, see alignment E=4e-23 PF08242: Methyltransf_12" amino acids 45 to 132 (88 residues), 51.5 bits, see alignment E=4.9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0026)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725Q5 at UniProt or InterPro

Protein Sequence (262 amino acids)

>DVU3369 conserved domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MWNAEDVKSFLDWADTPAGAFALRHERRLLQHLVSGWPRRGHSLLDVGCGPGIFLEYFWE
SGFDVTGLDASPDMLAAARSRLGPRADFHLGVGDHLPFEDNAFDYVTLLNVLEFVDDAAA
VLAEAFRVAARGVLVAVLNRWSPYYLSHGVPMPGSSSRLRQARWRSLPEMLRLVRQGCGG
CAVTWRTVLHAPSCTWREGTLFNLCNRGIALNPFGAYLALRVDTGRGLPVTPLLLTTRKT
APMRVCPPTVVGRTGHGRDLSS