Protein Info for DVU3363 in Desulfovibrio vulgaris Hildenborough JW710

Name: sun
Annotation: sun protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 PF01029: NusB" amino acids 36 to 158 (123 residues), 77.2 bits, see alignment E=2.4e-25 PF22458: RsmF-B_ferredox" amino acids 186 to 251 (66 residues), 27.8 bits, see alignment E=3.5e-10 PF01189: Methyltr_RsmB-F" amino acids 398 to 486 (89 residues), 93.8 bits, see alignment E=1.8e-30

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to dvu:DVU3363)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725R1 at UniProt or InterPro

Protein Sequence (507 amino acids)

>DVU3363 sun protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTSLTSDLPCPQPGVLFPDFAPVLRDRKRLSCVPPARAGALVALDAVVRAGVDVQAALDD
SLSHASLSRQDAALCTELVYGYLRSEIRLSWLVRRFLKAPSKLPPGVLALLCLAAYELTQ
CDRVPAYATLDWAVSAVRALYGTGVSRLANAVLRNVDRLGDAWRVADFYACVGDNRDRLC
VRHSAPRWLVDLWCDGYGEEKTTALLEASLLHPAPGVRINLARADGADCLQQLLSGNAGT
GRQAAGKAGVVFTSGGTPSEVTSLVSEGRASRQSGASQSALAALEPEVWPGPVWDCCCGR
GGKTAALVETGVAVVAASDPSMSRLRGLRRDFARLGLPVPLAVRASAVRPPFSCAASMAR
AGSCGDGGSPLAIDGIEVEVSRGQSATGLVNASGLGSGGLFGTILVDAPCSGLGTLSRRP
DIKRKRTTAQIAELVALQEAILDAVWPCLRSDGVLAYITCTRNPQENELRIAAFLERHLD
ARLEIAYETPLEDVSREFFYAARLRKA