Protein Info for DVU3334 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent DNA-binding response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 84.4 bits, see alignment E=2.3e-27 PF14532: Sigma54_activ_2" amino acids 148 to 315 (168 residues), 68.7 bits, see alignment E=2.3e-22 PF00158: Sigma54_activat" amino acids 149 to 309 (161 residues), 217.6 bits, see alignment E=3.2e-68 PF07724: AAA_2" amino acids 166 to 270 (105 residues), 27.7 bits, see alignment E=9.1e-10 PF07728: AAA_5" amino acids 168 to 286 (119 residues), 39.2 bits, see alignment E=2.5e-13 PF00004: AAA" amino acids 168 to 286 (119 residues), 38.3 bits, see alignment E=6.1e-13 PF02954: HTH_8" amino acids 407 to 445 (39 residues), 23.5 bits, see alignment 1.3e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0058)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725U1 at UniProt or InterPro

Protein Sequence (449 amino acids)

>DVU3334 sigma-54 dependent DNA-binding response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPHADLDVLIVDDDEAIVRTLLIGLKGMGCRTRGAHSPSAALETLRRHPADLVLTDMRM
EERTGVDLIREVSMLYPHTVCVIMTAFASYENAVAAIKAGAFDYMPKPFGMDQLQHLVRK
VSTLIGLRRENARLRDEAAPDWFSGLTSPASRALEGLIDRIAPTDATMLFTGETGTGKTE
LARTLHRRSHRAARPFVEVTCTTIAETLFESEVFGHARGAFTGAVKDHAGKFEQANGGTL
FLDEVGDLAPAMQSKLLRFLDDRVIERVGGSAGIELDVRVIAATNRDLTQMVAEGTFRED
LYYRLNTFECHIPPLRERREDIPPLATRLLHRALVRYPSEHPPVITEEVLHLLMSHDWPG
NVRELRNVMERATLLCAGGPITPSHLPPALVAGEGAVATVKDGIPSLREVEEAHIRKVLG
MGFSMERAADVLGITTVTLWRKRKEMGTT