Protein Info for DVU3326 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: multidrug resistance protein, Smr family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 8 to 96 (89 residues), 74 bits, see alignment E=6e-25

Best Hits

Swiss-Prot: 52% identical to MDTI_SALAR: Spermidine export protein MdtI (mdtI) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K11742, spermidine export protein MdtI (inferred from 100% identity to dvu:DVU3326)

MetaCyc: 49% identical to multidrug/spermidine efflux pump membrane subunit MdtI (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-350; TRANS-RXN0-266

Predicted SEED Role

"Spermidine export protein MdtI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725U9 at UniProt or InterPro

Protein Sequence (106 amino acids)

>DVU3326 multidrug resistance protein, Smr family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAWSFVLAVMLAAALEVAANLLLSRSDGFRRLGLASSALVLVGLAFTCLAYAVRGMDLAV
AYALWGGFGILGTSLGGWWLHGQRLKPAAWAGMALLIGGMALLHLA