Protein Info for DVU3251 in Desulfovibrio vulgaris Hildenborough JW710

Updated annotation (from data): nitrite transporter, HPP family
Rationale: Specifically important in stress Sodium nitrite; nitrogen source Sodium nitrite; stress Sodium nitrate. Related to Synpcc7942_1745, which is a nitrite transporter (PMID:24904028), but it is not clear why this is important both during nitrite stress and when nitrite is the N source
Original annotation: membrane protein, HPP family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 79 to 117 (39 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details PF04982: HPP" amino acids 53 to 175 (123 residues), 155.1 bits, see alignment E=4.6e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0138)

Predicted SEED Role

"membrane protein, HPP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726B4 at UniProt or InterPro

Protein Sequence (179 amino acids)

>DVU3251 nitrite transporter, HPP family (Desulfovibrio vulgaris Hildenborough JW710)
MRHYFGKMRGCGRSQCAADPLEAAWSFIGAICGIGLVAWLCEHLASPSDGAILIGSFGAS
AVLAYGAPAGPLSQPRNLVGGHVLSALVGVATWQALGGTPWLAAAVAVGTAIALMHMTGT
LHPPGGATALIAVTGSPAIHDLGYGYVVAPVGAGAFIILGVALVINNIPKHRRYPQHWW