Protein Info for DVU3243 in Desulfovibrio vulgaris Hildenborough JW710

Name: dnaJ
Annotation: dnaJ protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR02349: chaperone protein DnaJ" amino acids 5 to 351 (347 residues), 434.6 bits, see alignment E=1.7e-134 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 97.8 bits, see alignment E=4.6e-32 PF01556: DnaJ_C" amino acids 123 to 336 (214 residues), 162.4 bits, see alignment E=1.3e-51 PF00684: DnaJ_CXXCXGXG" amino acids 150 to 210 (61 residues), 56.5 bits, see alignment E=4e-19

Best Hits

Swiss-Prot: 100% identical to DNAJ_DESVH: Chaperone protein DnaJ (dnaJ) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to dvu:DVU3243)

MetaCyc: 49% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725M6 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DVU3243 dnaJ protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSQRDYYEVLGVARDASEDDIKRAYRKLALQYHPDRNPDDPEAEQKFKEAAEAYDVLRDG
EKRARYDRFGHAGVGNGGGFGQGFSSNEDIFAHFSDIFGDLFGFAGAAGGRSRGPRPQAG
SDLRYNLTISFRQAAKGDEVTLRLPKSVPCDECGGSGAAPGTRPETCRHCGGAGQIRQSQ
GFFQIAMPCPVCRGEGTVITSPCPKCKGSGQTQQVKELSVRIPAGVDTGNRLRLRGEGEP
GIHGGPAGDLYVVISVEDDKTFRRQGQDLVVTREISFVQASLGDRIDVPTLDDDITLDIP
AGTQSGEVFRLVDKGLPYLGHGHTGDLLVEIRVVTPTRLTKKQEELLREFALLDEEKPLE
KVKKMARKIGKAMGMD