Protein Info for DVU3234 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: flagellar biosynthetic protein FliR (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 154 to 157 (4 residues), see Phobius details amino acids 178 to 203 (26 residues), see Phobius details amino acids 214 to 240 (27 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 13 to 246 (234 residues), 189.8 bits, see alignment E=3.2e-60 PF01311: Bac_export_1" amino acids 13 to 244 (232 residues), 219.1 bits, see alignment E=3.2e-69

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to dvu:DVU3234)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q3V886 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DVU3234 flagellar biosynthetic protein FliR (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDLFAFDPATTLGFLLTFMRVSLVMFLLPFFGGDAVPMQVKVALCLVMAMALWPRLSLAG
AVMPSHPFELVVMLASELVLGLVLGMAVHFLFAGIQTGGQLLGFQMGFTMISIADPLSGA
QISITSHFLYMVSLLTFLALDGHLFLLRAFAESFALVPAGGLVANPAVANELVRLAGGMF
VIAVKIAAPVLVTLFLVELALALMARAAPQMNLLMIGFPLKIAVGFFFMGLLFTILAQYI
EEFIIGMPPMMLHLLHGVSPKGV