Protein Info for DVU3233 in Desulfovibrio vulgaris Hildenborough JW710

Name: flhB
Annotation: flagellar biosynthetic protein FlhB (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details PF01312: Bac_export_2" amino acids 7 to 345 (339 residues), 396.3 bits, see alignment E=6.3e-123 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 7 to 351 (345 residues), 368.4 bits, see alignment E=1.9e-114

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to dvl:Dvul_0155)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q3V887 at UniProt or InterPro

Protein Sequence (357 amino acids)

>DVU3233 flagellar biosynthetic protein FlhB (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAQKDPSRTEQATRKRLNKARNKGNVAKSQEVSKAVTTFAGLVAITFMLGVLNEHMQEVF
RFFLSRPHDFTPNEQTVYSLLLWSAGELAIMLLPIMLFIGLAAFIAMRLQVGKLWTTEVF
KLDWSRFNVINALKRMFISPQTLIRLGKSLLQAVFIGIAPIIVLKQEMLNLLPLYFADMS
GIAVYMLETGARMVKYALVPMVIIAAVDLWYTRWDYNENLKMTKDEVKDERKQAEGDPVV
KSQQRQKMMKVMAQRMLKEVPTADVVITNPTHIAVALRYDVTAAPAPIVVAMGADHLAKR
IREVAREHNVPIRENKPLARALYKSVEVGDMIPAELYKAVAAILAGLAKFRPQARGV