Protein Info for DVU3194 in Desulfovibrio vulgaris Hildenborough JW710

Name: engA
Annotation: GTP-binding protein EngA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 TIGR00231: small GTP-binding protein domain" amino acids 3 to 163 (161 residues), 76 bits, see alignment E=4.4e-25 amino acids 227 to 373 (147 residues), 85.5 bits, see alignment E=5.1e-28 PF02421: FeoB_N" amino acids 4 to 61 (58 residues), 36.7 bits, see alignment 1.5e-12 amino acids 229 to 384 (156 residues), 42 bits, see alignment E=3.5e-14 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 482 (479 residues), 488.7 bits, see alignment E=2.6e-150 PF01926: MMR_HSR1" amino acids 4 to 131 (128 residues), 93.3 bits, see alignment E=5.5e-30 amino acids 229 to 346 (118 residues), 91.1 bits, see alignment E=2.7e-29 PF04548: AIG1" amino acids 228 to 334 (107 residues), 28.8 bits, see alignment E=3.9e-10 PF00009: GTP_EFTU" amino acids 230 to 389 (160 residues), 47.4 bits, see alignment E=8.8e-16 PF14714: KH_dom-like" amino acids 402 to 482 (81 residues), 98.3 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 100% identical to DER_DESVH: GTPase Der (der) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to dvu:DVU3194)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725L9 at UniProt or InterPro

Protein Sequence (491 amino acids)

>DVU3194 GTP-binding protein EngA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFAKIALVGRPNVGKSTLFNRLIRSNRAITHDMPGVTRDRMEGIVRGRNKRPFGIIDTGG
ITLDGHAAVAEGPAGIRGFEAEILRQAEEAIAECVAVCLVVDGREGLLPFDEHLASYLRR
TGKPVLVVVNKVDGIEKEDVLTAEFHILGFPVLAVSAEHGHNLRWLESEMRDLLPEEDED
GIDDDAADATAVAIADADAETEDGASASETEEDITEETVEDEPEAPLRLCMLGRPNAGKS
SLVNALTGTNRMIVSDVAGTTRDSVDVAFEKDGLSYTFVDTAGVRRRSRITDTVERYSVN
SSLKSTTKAHVTLLVLDAVEGITSQDKRLIELLDERKTPFMVLVNKMDLVPAKAREDGKR
NFRDLLNFCQHVPLLFVSAKTGYELRSIVPLAARIRRECSVRIPTGQLNRAMEEVITRHQ
PPVVRRVRPKFYYMTQAESQPPTFVLFVNDADRIQAPYAKYIEKSLRRLFGIEHAPMRVH
FRSSHKKNSEK