Protein Info for DVU3192 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl transferase, group 1 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF13439: Glyco_transf_4" amino acids 15 to 180 (166 residues), 30.9 bits, see alignment E=5.5e-11 PF20706: GT4-conflict" amino acids 182 to 316 (135 residues), 32.6 bits, see alignment E=8.7e-12 PF00534: Glycos_transf_1" amino acids 201 to 327 (127 residues), 116 bits, see alignment E=2.7e-37 PF13692: Glyco_trans_1_4" amino acids 202 to 327 (126 residues), 106.4 bits, see alignment E=3.1e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3192)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725K2 at UniProt or InterPro

Protein Sequence (386 amino acids)

>DVU3192 glycosyl transferase, group 1 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPPVVCFCNTNPGWGGGEKWHLEAAIALAHRGRRVLLMAHPAGRLHAEASRLAATLPAH
LPGLRVLPLQVGRLTFLNPGAIVRIAHVLHREKVDSLVLGLTSDLKAVGPAARLAGVRQV
FYRRGSALPIRNTALNRLLYGRVINGLIVNSQETRRLALVNNAGLIPEERIHLLHNGIDA
TGFDAALKKASPAYRAGGHTLVIGNAGRLNRQKGQHHLLHMARLLADEGLDFRLVIAGEG
ERRQELETLARTLGVSGHVVFAGFLADLAPFWKSLDVFVLSSHWEGFGYVLAEAMLAEVP
VVSFDVSNIPELVQDGTNGLLVPGPDAAPEGDAAPAAGLARAVMTMAASQGLRCRMGAAG
RAHALAKYAQESCMDALESILGSAPR