Protein Info for DVU3179 in Desulfovibrio vulgaris Hildenborough JW710

Name: ispB
Annotation: octaprenyl-diphosphate synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 101 to 119 (19 residues), see Phobius details PF00348: polyprenyl_synt" amino acids 29 to 255 (227 residues), 213.3 bits, see alignment E=1.7e-67

Best Hits

KEGG orthology group: K02523, octaprenyl-diphosphate synthase [EC: 2.5.1.90] (inferred from 100% identity to dvl:Dvul_0208)

Predicted SEED Role

"octaprenyl-diphosphate synthase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726C0 at UniProt or InterPro

Protein Sequence (321 amino acids)

>DVU3179 octaprenyl-diphosphate synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQELKARIIAEQPRFNATLATEVGTLHPLVQPVAAHVLKAGGKRLRPLLTLLVARALGYA
DDDIYPLACSVELLHSATLLHDDILDDADLRRGMAAAHTVFGSTATVLAGDALLALANLI
VARYGDPRLTACISEAIIRTATGEIVEIAHMRGTDHGRDTYIDIITGKTAWMLRASCELG
ALRAGASEEAVRAAAAFGLDLGIAFQIVDDALDFADRADTGKPVGGDLREGKLTPPLIYY
LETLSGPEREAFISRFRDGGFSGDDVARISAEIRALGIIERTRELAGNYIEKAAASLETL
PDCPERRTLMQTLAYVQHRDR