Protein Info for DVU3168 in Desulfovibrio vulgaris Hildenborough JW710

Name: hemL
Annotation: glutamate-1-semialdehyde-2,1-aminomutase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR00713: glutamate-1-semialdehyde-2,1-aminomutase" amino acids 5 to 421 (417 residues), 598.7 bits, see alignment E=2.5e-184 PF00202: Aminotran_3" amino acids 33 to 395 (363 residues), 266.6 bits, see alignment E=1.6e-83

Best Hits

Swiss-Prot: 100% identical to GSA_DESVH: Glutamate-1-semialdehyde 2,1-aminomutase (hemL) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01845, glutamate-1-semialdehyde 2,1-aminomutase [EC: 5.4.3.8] (inferred from 100% identity to dvl:Dvul_0218)

Predicted SEED Role

"Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 5.4.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725I1 at UniProt or InterPro

Protein Sequence (423 amino acids)

>DVU3168 glutamate-1-semialdehyde-2,1-aminomutase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSQRSSELFERAQQLIPGGVNSPVRACLGVDSEPLFIARAAGSRLHTVDGETFIDFVESW
GPMLLGHTHPEVTAAVHAAVDRGTSYGAPCEDEVVLAAKVVDALPGVDMVRMVNSGTEAT
MSALRLARGYTGRTKLVKFVGCYHGHADPFLASAGSGVATLSIPGTPGVPESTVRDTLLA
PYNDLAAVKDLFALHGKDIAAIIVEAVAGNMGLVPPKAGFLEGLRELCDQHGALLIFDEV
ITGFRVSFGGAQQRFGITPDLTTLGKIIGGGLPVGAYGGKREIMQRIAPCGEVYQAGTLS
GNPLAMAAGIATLDVLSRSDYAGLEARVAAFVKELEAILKGKGVPVRINTLASMFTVFFT
NDPVTDFASAKTADGALYTSFYKQMRAQGIYLAPSPFEAAMVSFAHTDDDLAAMLDAARK
VTF