Protein Info for DVU3164 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 70 to 97 (28 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 265 (153 residues), 52 bits, see alignment E=3.8e-18

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to dvu:DVU3164)

Predicted SEED Role

"inner membrane component of binding-protein-dependent transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725I5 at UniProt or InterPro

Protein Sequence (277 amino acids)

>DVU3164 ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKQTNIYDSRGLARALDTTAAWTLAIMWALPLLYAIWTAFHPSAYSTRFTLNAPLTLENF
VTAWHAAPFALYFVNTVLLVTMVLAAQLVLCTLAAYAFAKYDFRGKNIMFALVLMQLMIM
PDVLVVENYRTMASIGVLDSTLAIGLPYMASAFGIFLLRQTFKSIPKELDEAAAVEGAST
LQILWKVYVPLGKPVYLAYALVSISYHWNNFLWPLIVTNTTNSRPLTVGLQVFSSTEQGV
DWAIITAATLMTSGPLLVAFLLFQRQFVQSFMRAGIK