Protein Info for DVU3159 in Desulfovibrio vulgaris Hildenborough JW710

Name: gpsA
Annotation: glycerol-3-phosphate dehydrogenase (NAD(P)+) (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03807: F420_oxidored" amino acids 2 to 105 (104 residues), 33.4 bits, see alignment E=1.7e-11 PF01210: NAD_Gly3P_dh_N" amino acids 2 to 158 (157 residues), 168 bits, see alignment E=5.1e-53 PF02558: ApbA" amino acids 3 to 109 (107 residues), 36.1 bits, see alignment E=1.4e-12 PF07479: NAD_Gly3P_dh_C" amino acids 179 to 320 (142 residues), 192.3 bits, see alignment E=1.4e-60 PF20618: GPD_NAD_C_bact" amino acids 239 to 304 (66 residues), 81.6 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 100% identical to GPDA_DESVH: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to dvu:DVU3159)

MetaCyc: 45% identical to glycerol-3-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61739 at UniProt or InterPro

Protein Sequence (330 amino acids)

>DVU3159 glycerol-3-phosphate dehydrogenase (NAD(P)+) (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKIAVLGGGSWGTALAHLLAGKGEDVRLWVRDPAVVEGVNRDHENPRYLKGLHLHEALRA
TCDAGEALEGADILLSVVPCQQTRTVLRSLRPRLKTGMVVVSASKGIETDGLRTVGEMVE
DELAGLAPRYAVISGPSFAAEVVAGMPTAVVLGCADRDLGGTLREVFSTPTFRTYSCTDV
RGVELGGAVKNVIAIAAGLSDGLGFGSNARAGLITRGLAEMGRLGVALGARGSTFMGLSG
LGDLVLTCTGDLSRNRQVGLRLAEGQGLDAIVAGMGMVAEGVKTTEAVYELAQREGVDLP
ITQAMYAVLHDGRDPRDMVQELMTRELREE