Protein Info for DVU3142 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent transcriptional regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 TIGR00229: PAS domain S-box protein" amino acids 7 to 130 (124 residues), 61.3 bits, see alignment E=5e-21 PF00989: PAS" amino acids 8 to 114 (107 residues), 37 bits, see alignment E=1.4e-12 PF08448: PAS_4" amino acids 14 to 125 (112 residues), 36.9 bits, see alignment E=1.7e-12 PF13426: PAS_9" amino acids 18 to 123 (106 residues), 52.9 bits, see alignment E=1.7e-17 PF00158: Sigma54_activat" amino acids 147 to 313 (167 residues), 228.7 bits, see alignment E=1.6e-71 PF14532: Sigma54_activ_2" amino acids 148 to 318 (171 residues), 61.4 bits, see alignment E=5e-20 PF07728: AAA_5" amino acids 170 to 290 (121 residues), 33 bits, see alignment E=2.6e-11 PF00004: AAA" amino acids 171 to 306 (136 residues), 21.2 bits, see alignment E=1.5e-07 PF02954: HTH_8" amino acids 521 to 557 (37 residues), 37.5 bits, see alignment 7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3142)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726G6 at UniProt or InterPro

Protein Sequence (567 amino acids)

>DVU3142 sigma-54 dependent transcriptional regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHETDPRFLRGIIDTLNEGLVFVGPDGRIRMVNPALERLTGFTRDELVGRACSVLQCDAC
VRQRKDGGAHWCRLFDRKGENRKRCTVRRKDGTVVPVLKNARVLTDGQGGVQGAVEIITD
LSELVDKERRIEELSRLLGSEEGFAGMVGASSAMHRTFRLLERAAESDAPVLLLGASGTG
KELAARAVHELGRRRNGPYVQLNCAALNENLLESELFGHVRGAFTGAVRDRQGRFEAAHG
GDLFLDEIGDLPLPTQVKLLRVLETKRIERVGDNHPREVDVRIIAATNRNLGALVRAGRF
REDLLFRINVIPVTLPALAARREDIPLLAAFFLRAITERDGRKAGGLTPAALRHLVAYTW
PGNVRELRSAMEYACVVAGGGDIDAEHLPPHIIDGTPECGGHALAATVAERTGPDAAQEA
PADEVRPDAPVRVAGPGAGGGTQGRAGEVGAVAAIPVVSAVPVVPAVPVVTDSGPDHEMM
SVDAHDRVMSLPGTSGEAGTPPPAMADAFPPTQRELREGEERRQLLTALRRARGNISEAA
RLLGVYRGTVRNRMARYGIDLHREVKG