Protein Info for DVU3135 in Desulfovibrio vulgaris Hildenborough JW710

Name: mdaB
Annotation: flavodoxin-like fold domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF02525: Flavodoxin_2" amino acids 3 to 190 (188 residues), 92.6 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 49% identical to MDAB_ECOLI: Modulator of drug activity B (mdaB) from Escherichia coli (strain K12)

KEGG orthology group: K03923, modulator of drug activity B (inferred from 100% identity to dvu:DVU3135)

MetaCyc: 49% identical to NADPH:quinone oxidoreductase MdaB (Escherichia coli K-12 substr. MG1655)
RXN0-271 [EC: 1.6.5.10]

Predicted SEED Role

"flavodoxin-like fold domain protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726H3 at UniProt or InterPro

Protein Sequence (202 amino acids)

>DVU3135 flavodoxin-like fold domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSHVLIINGHEPYPRSPGRLNSHLVEVARSVLVGMGHSVEVVATNGDYDIDAEVDRHVRA
DTVIVQSPVNWMGFPWSCKRYMDYVYLAGMDGRLCTGDGRSRSDPARQYGSGGTCGGKTY
MLSLTFNAPPEAFGDAGQYLFQGRTVDDLFFPAHMNFRFLGMTGLPTFVSYDVIKNPDVA
RDVARYEAHLASAFGMAATSGA