Protein Info for DVU3108 in Desulfovibrio vulgaris Hildenborough JW710

Name: nhaC-2
Annotation: Na+/H+ antiporter NhaC (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 141 to 168 (28 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 358 to 384 (27 residues), see Phobius details amino acids 409 to 433 (25 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details TIGR00931: Na+/H+ antiporter NhaC" amino acids 10 to 462 (453 residues), 393.1 bits, see alignment E=8.4e-122 PF03553: Na_H_antiporter" amino acids 41 to 179 (139 residues), 27 bits, see alignment E=1.4e-10 amino acids 165 to 457 (293 residues), 149.5 bits, see alignment E=6.6e-48

Best Hits

KEGG orthology group: K03315, Na+:H+ antiporter, NhaC family (inferred from 100% identity to dvu:DVU3108)

Predicted SEED Role

"Na+/H+ antiporter NhaC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726J9 at UniProt or InterPro

Protein Sequence (475 amino acids)

>DVU3108 Na+/H+ antiporter NhaC (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDTAARPMERRPSTAYALATFCIPVAVILYGTVVMAIRPPVLPLIAAVGLAALMVMRTGY
RWNELQQGMFEALGRVQIAVFILVLVGMLIGAWIACGTIPLIIYWGLRLIAPESFLLSSF
VLCGVASIATGTSFGTMGTLGVALLGVGEALGFPAAMTVGAVVSGAYLGDKMSPASDSTN
IAASVCEVDLFDHIGSMMWTTVPAALVAGVVYSVLGVLHVQGQAVPLEGIRGILSALEQH
HSLSLVGVIPPLVMLVLAYMRLPVVPVMAACVLSAAGIALFEGHALRDVAVSMTTGFKSA
TGVKQLDMLLSRGGMMSVMPTVLLLSAGVAFGGVLERSRTLEVLIEAVLRGARSTVRLVG
SSLLACYIILLGTGSQLLAAIIPARAFADAFRAQDIHLKVLSRTCEDGGTIGCPLVPWSV
HAFYILGVLGVSALDFGPYAVLNWIVPVFSMLCAASGIGVWRADGTGVRQGKASA