Protein Info for DVU3081 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details PF00892: EamA" amino acids 15 to 146 (132 residues), 84.2 bits, see alignment E=1.1e-27 amino acids 161 to 293 (133 residues), 85.2 bits, see alignment E=5.3e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0297)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726M5 at UniProt or InterPro

Protein Sequence (300 amino acids)

>DVU3081 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTSHTLTQGGRTTATIALLLAMLLWSSSFIAMKIALTGFDPMVMIFGRMAIASVIFIAVW
RRNFSGVRYRAGDWKLLGFMTMCEPCLYFVFEAYALEYTSASQAGMIVAMMPLSVAVAAR
FVLKEHMARSAWAGFCLAIAGVVWLSLGGQVTENAPNPMLGNALEVCAMLTATGYVISAK
RLSSTYPPLFITAVQSLAGFVFFLPVLALPGVTLPTSLPLTPTLAVLYLGVCITLGAYGL
YNYGVSRLPAGQAASYINLIPVLTLIMGRVVLGDELSPSQYLASLLVLAGVVLSQRRAAA