Protein Info for DVU3068 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GAF domain/sensory box/EAL domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 827 TIGR00229: PAS domain S-box protein" amino acids 278 to 401 (124 residues), 67.9 bits, see alignment E=8.9e-23 amino acids 402 to 522 (121 residues), 33.2 bits, see alignment E=5e-12 amino acids 523 to 644 (122 residues), 69.7 bits, see alignment E=2.5e-23 PF00989: PAS" amino acids 282 to 388 (107 residues), 34.9 bits, see alignment E=4.9e-12 amino acids 527 to 631 (105 residues), 24.2 bits, see alignment E=9.7e-09 PF08448: PAS_4" amino acids 287 to 394 (108 residues), 39.4 bits, see alignment E=2.2e-13 amino acids 533 to 638 (106 residues), 38.6 bits, see alignment E=3.8e-13 PF13426: PAS_9" amino acids 292 to 393 (102 residues), 38.7 bits, see alignment E=3.7e-13 amino acids 538 to 636 (99 residues), 35.3 bits, see alignment E=4.1e-12 PF13188: PAS_8" amino acids 406 to 446 (41 residues), 32.1 bits, see alignment 2.7e-11 amino acids 527 to 577 (51 residues), 29.8 bits, see alignment 1.4e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 646 to 808 (163 residues), 162.9 bits, see alignment E=5.4e-52 PF00990: GGDEF" amino acids 648 to 805 (158 residues), 142 bits, see alignment E=5.1e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3068)

Predicted SEED Role

"GAF domain/sensory box/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726N8 at UniProt or InterPro

Protein Sequence (827 amino acids)

>DVU3068 GAF domain/sensory box/EAL domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNTFAIPAPLIDAWRTTLETLRNLTGLGFGLLTRENGGELEIMVTAGELPSPFAEGYCLK
GGPEGPLCAVVHTLARSLLIPDTTADARWASNPAVKAGVRAYFGLPLRLPTGALFGTLCL
GSMSPVTGHDAVLKPLHCFATLVEQHIALLSTNALLRSQLDALPGASFASDPHGQMLFAS
NRCGSLLDLHPADIPGSDVDTVFNRIAALCESPEECHAILRRSFTLGGPSNGKLAFDDGR
TIRWQARRLREDAGSVLGCTWFLEDATAELQARAGLTRSEALFRGLFNNAAVGIVLLDRQ
GFVVRSNVACARMLGTSPEQMHGLSFRAVLPPEDADQHLEEMQSLAEGETDELHGCWEML
HRNGSRLRVDLHGARLPGSGEEVVMLVGVDVTEQWRTERALAESERRYRALFDNAQAGIF
RTSLADGTFLEANLRMAQMFGYDDVATFMAEYRAAENYVDPADRALMLDRLRTSGSFATM
ETHMRRRDGTTTWFLYSGTLDGDTIIGVANEISEMRATQEALRRSEERYRALFDNAADGL
LLYEADGTLIDVNETIARRLGESREAIVGRNVASIVEPEVLERVRPRLAEILETGHASFE
SVHRTAMGPVNVEVHARRIEFEGRFVVLSSARDITERKNLEAALLREATTDPLTGGRNRR
QFFVDANREFARALRHDSGLAVLMLDIDHFKNVNDLYGHQAGDEVLRAFAACCVEALRAY
DVFGRLGGEEFAALLPAASPEEAMETAERLRKRVERRSVVYEGTALQCTVSVGVTSLAAA
DLGFDDMLRRADRALYAAKDHGRNRSEMAPMPMVPAEIPPPRKPFRE