Protein Info for DVU3064 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box/GGDEF domain/EAL domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 TIGR00229: PAS domain S-box protein" amino acids 42 to 143 (102 residues), 36 bits, see alignment E=6.7e-13 PF08447: PAS_3" amino acids 48 to 130 (83 residues), 33.9 bits, see alignment E=4.6e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 147 to 307 (161 residues), 115.3 bits, see alignment E=2.3e-37 PF00990: GGDEF" amino acids 151 to 305 (155 residues), 135.2 bits, see alignment E=2.9e-43 PF00563: EAL" amino acids 328 to 564 (237 residues), 252.9 bits, see alignment E=4.1e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3064)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726P2 at UniProt or InterPro

Protein Sequence (576 amino acids)

>DVU3064 sensory box/GGDEF domain/EAL domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPDGVPGAVSAVASATPGTESLPSPFDILADHLADWECWESPEGRVHFVTPACQRISGFG
IDNFRAHHLFIEGLIHPDDLPAWRRHREMLTASLPKAEVEIRIRTAEGGEKWLAVTSRNL
TDGHGEPLGIRSSLRDITDRKMVLSQLRHQAWHDPLTGLPNRALCLDRLDRALGRLARGN
GELCAVVFLDLDRFKLVNDTLGNAAGDRVLRETARRLGTATRSTDTVSRLGSDEFIILIE
DLRGEDEARATLGRLREAQRAPFDIDGRHLRVTASMGVVLARGGNADEVLRNANIAMHHA
KEHGGDAASFFHASMLEEALDLMQLEIDLHRALENDEFFLVYQPIVSVVDRRITGFEALL
RWRHPERGVVGPDAFIALAEHSGLIHLLGRKALDEACRTLAKWRRVDQLFDGLTMHVNLS
ARQLSQTHIVEQVAEALRDSCLPPHLLKLEVTETMLMENPDYANAVLCRLRDIGVGVCVD
DFGTGYSSLSYLQRFPIDTLKVDRSFVSRMTREPGQFKIVQAVIALAHSLGLEVVAEGVE
DEEQRIMLLGLACRYAQGFLFAKPLAAEDVPAHVTG