Protein Info for DVU3055 in Desulfovibrio vulgaris Hildenborough JW710

Name: rne
Annotation: ribonuclease, Rne/Rng family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR00757: ribonuclease, Rne/Rng family" amino acids 21 to 432 (412 residues), 447.3 bits, see alignment E=2.7e-138 PF10150: RNase_E_G" amino acids 131 to 402 (272 residues), 323.8 bits, see alignment E=1.3e-100 PF20833: RNase_E_G_Thio" amino acids 414 to 486 (73 residues), 49.3 bits, see alignment E=6.5e-17

Best Hits

KEGG orthology group: K08300, ribonuclease E [EC: 3.1.26.12] (inferred from 100% identity to dvl:Dvul_0321)

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.-

Use Curated BLAST to search for 3.1.26.12 or 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726Q1 at UniProt or InterPro

Protein Sequence (489 amino acids)

>DVU3055 ribonuclease, Rne/Rng family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTAKKGKRKMYISVLPGEQVEVALSEDGAVTEYYVEMLHQAKTKGNIYKGVINNIDTNL
QAAFVNYGAEKNGFLQIDEVHPEYYISPHDPTKGKKYPLMQKVLKAGQEVLVQVVKEPTG
NKGAFLTSYLSLPGRFLVLTPGREQIGVSRKVEDDEERSRLREMLEGLSAGPGLGVIVRT
VSAGTSKTTLQRDLQFLKRLWKDVRKKGTTEQTPCQIYQEPDLATRSVRDYLTDDVSEVW
VDDAATAELIREFVTLVFPRKASLVKLHTDPERTLWERFGIRKQLDQIYSREVILPSGGR
LVFDQTEALMAIDINSGKIAGKTNFESMALKTNTEAAESIAQQLRLRDIGGQVVIDFIEM
RDHNHWREVEKTLRNAMKGDRARHDVGKMSRFGLLQVVRQRTGSSALSITMEACPCCRGS
GLRRNMEWQSLQALRELHRQLRALPQGQCVHVFETSPELAFYLLNHKRERLLELERRFNL
RLEVRPTGK